PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016467435.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 117aa    MW: 13633 Da    PI: 10.8993
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016467435.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF862.1e-271059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    ri+n + rqvtfskRrng+lKKA+ELS+LCdaev +iifsst kly+++s
  XP_016467435.1 10 RIDNITSRQVTFSKRRNGLLKKAKELSILCDAEVGLIIFSSTAKLYDFAS 59
                    8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.469161IPR002100Transcription factor, MADS-box
CDDcd002653.39E-42278No hitNo description
SuperFamilySSF554554.06E-32280IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.4E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MGRGKIAIRR IDNITSRQVT FSKRRNGLLK KAKELSILCD AEVGLIIFSS TAKLYDFAST  60
SMRSVIERYN KVMEEDHNLM NPMSEVKTNK DNSQRAILLT RLKFLMRQDF LYNTIKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J8e-21291182Myocyte-specific enhancer factor 2A
3p57_I8e-21291182Myocyte-specific enhancer factor 2A
3p57_D8e-21291182Myocyte-specific enhancer factor 2A
3p57_C8e-21291182Myocyte-specific enhancer factor 2A
3p57_B8e-21291182Myocyte-specific enhancer factor 2A
3p57_A8e-21291182Myocyte-specific enhancer factor 2A
3kov_J8e-21291182Myocyte-specific enhancer factor 2A
3kov_I8e-21291182Myocyte-specific enhancer factor 2A
3kov_B8e-21291182Myocyte-specific enhancer factor 2A
3kov_A8e-21291182Myocyte-specific enhancer factor 2A
1tqe_S8e-21181181Myocyte-specific enhancer factor 2B
1tqe_R8e-21181181Myocyte-specific enhancer factor 2B
1tqe_Q8e-21181181Myocyte-specific enhancer factor 2B
1tqe_P8e-21181181Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016467435.12e-81PREDICTED: MADS-box transcription factor 23-like
SwissprotQ9SI383e-44ANR1_ARATH; MADS-box transcription factor ANR1
TrEMBLA0A0B2QFT06e-49A0A0B2QFT0_GLYSO; MADS-box transcription factor 23
TrEMBLA0A0R0FWL78e-49A0A0R0FWL7_SOYBN; Uncharacterized protein
STRINGGLYMA13G32810.14e-47(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.12e-45AGAMOUS-like 44